PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10021399
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 175aa    MW: 20230.4 Da    PI: 9.3563
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10021399genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF36.84.9e-12950243
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                 + en s r   + +Rr   +KK eELSvLC++e+  +++s++
  Lus10021399  9 FMENRSARLHCLKNRRRNFMKKVEELSVLCGVEAFAVVYSPD 50
                 67999***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.0E-10159IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.274148IPR002100Transcription factor, MADS-box
CDDcd002661.27E-17164No hitNo description
SuperFamilySSF554558.76E-16275IPR002100Transcription factor, MADS-box
PfamPF003194.3E-121050IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MRKKVKLAFM ENRSARLHCL KNRRRNFMKK VEELSVLCGV EAFAVVYSPD EPGFAVWPRN  60
EAEAQQVLLK YQTIPEDAHQ ADNKLDQEKY LEGLISKLQA KQRVQLKRTD ELEFAYLMDE  120
VHFGKGLDGM DLHEVNSLSL LIKDRLRNLR ERAKKLEITT KNGVAIDALL YENK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.15e-21AGAMOUS-like 80